1. Notes: 31 / 2 weeks ago  from tumbledore
    tumbledore:


82°06′S 54°58′E — the most inaccessible point in Antarctica, the farthest from the ocean, and the coldest place in the world. Located there is a bust of Lenin staring off towards Moscow.Twenty feet below is an old Soviet research hut.
(via)

    tumbledore:

    82°06′S 54°58′E — the most inaccessible point in Antarctica, the farthest from the ocean, and the coldest place in the world. Located there is a bust of Lenin staring off towards Moscow.Twenty feet below is an old Soviet research hut.

    (via)

     
  2. 1 month ago 
     
  3. 1 month ago 
    Scientists discover gene that 'cancer-proofs' rodent's cells
  4. Notes: 44 / 1 month ago  from topherchris
    topherchris:

GeoCities, 1994-2009

    topherchris:

    GeoCities, 1994-2009

     
  5. Notes: 24 / 1 month ago  from dalasverdugo (originally from personalhomepage)

    dalasverdugo:

    personalhomepage:

    How people count cash

  6. 1 month ago 
    http://www.smashingmagazine.com/2009/10/14/css-differences-in-internet-explorer-6-7-and-8/
  7. 1 month ago 
  8. Notes: 1680 / 1 month ago  from dalasverdugo (originally from spunkldavis)
     
  9. Notes: 3 / 1 month ago  from nerdology

    Online Identity. What's It Worth?

    nerdology:

    I was reading about Drew Carey yesterday… well not about him so much as about how he just bid 100,000 dollars for the @Drew twitter.  His online identity is so important that he is willing to pay 100,000 dollars for @Drew, forgoing his @DrewFromTV.  Drew Carey ownes DrewCarey.com, which currently only hosts a picture of his glasses.  There’s no way he paid more than the 9.99 Yahoo charges to register a domain, yet he’s willing to spend more than the average American’s salary on a twitter name.

    It’s crazy to think that a website.com/name could drum up that much cash.  You don’t hear about people spending tons of money for facebook.com/name, or name.blogspot.com.  But is this possible $100,000 for @Drew a sign that things are changing?

    Recently we’ve seen website names grow from one word to a few words to phrases.  No one even thinks to visit Funny.com but you’d go to CollegeHumor.com in a heartbeat.  Some movies end up with the longest names, often placing the entirety of the title into the dotcom.  So why is @Drew so much different from @DrewFromTV?

    I don’t have an answer.  But could it be that the internet is in some sort of regression.  Where as people used to spread out in their own corners of the internet, now they’re moving into shared social spaces.  You don’t need your own website when you can have a tumblr a twitter and a facebook.  And since you’re relying on other social services perhaps it’s worth spending them money to get what you want.

  10. Notes: 32 / 2 months ago  from doinwork (originally from meganlikescake)
     
  11. Notes: 1 / 2 months ago 
     
  12. Notes: 5 / 2 months ago  from doinwork (originally from grizzlby)
    [Flash 9 is required to listen to audio.]
  13. Notes: 1 / 2 months ago 
     
  14. Notes: 17 / 2 months ago  from aja
    aja:

The Ultimate Productivity Blog
     
  15. 2 months ago 
     
avatar_128
 
 
My name is Stuart Bennett. I'm interested in technology, unusual photography, web trends and developments.

If you need to contact me you can get in touch by email. Substitute the 'a' in my first name for an @, add my second name and suffix that with .com.

- Stuart Bennett
 
 

Following

topherchrisdalasverdugoajatumbledoredoinworknerdologydavidmarcodrewtlvxslantbacksoxiamcarodeleteyourselfpeterbakerjakelodwicksamreichpmcarthuramandalynferrijstncaseypughrickyvtedrodensangennarojoshmohrerandreaallenjacobboringloseroatssimonpanruckerericlodwickannatruussportsteampilejakeandamirblakewhitmanjuliaheffernantylerhwillisanjalouisemeghanashamareenerikkevintwohysituationistandrewglennflavinhumangiantfascinatedkevindavidcrowejuliaallisonnoahkalinamynylifesarahschneiderlfarmvincentpeonezachkleinrocketsciencefuckinnerdgoonerukpaulscheercaitlinoppermannhipsterrunoffbenjosephericstraussdihardjkatingerkarenabadmaryrambinrobhuebelomgpopstreeterannamariebreathingroomsarazuckerfrangryazizisboredirckateheffernanstaffjjaketuneagetofuttibreakbryanwashere1000lolzjeffrubinjeffrubinjakehurwitzsuzannexiejohnzanussitwentysomethingtalesmuxtapewillschneiderbritbiancarocksoutafuckadayfishyfunemployed147xxxxpaulstrawcorintrachtmannickmcglynnpatrickcasselsjasonmichaelsgiancarlofiorentiniannnnathisisacoolattitudepornoforpoppetsdailycreepevokeineedtooamironaimvulturerealtysuckafuckdearoldlovetamnationrroobbiinnrososoweclassyhilarysiegeljoshnsfwunlessyourjoballowsblowjobsfuckyeahsharksthismightsuckzolfaboutaframeinsooutsovimeobuzzeyeonspringfield43foldersoldpseudosodaprettifyvasiliisalastnightscobravogueadventureroadtrip2009daddylikesthemadeshopscanwicheslondonersannalodwicklookatthisfuckinghipsterwireframesimage-economylizshayalasexbitchesaestheticindulgencepicturesthatlooklikethis
 

Tumblr